General Information

  • ID:  hor005681
  • Uniprot ID:  P10082
  • Protein name:  Peptide YY
  • Gene name:  PYY
  • Organism:  Homo sapiens (Human)
  • Family:  NPY family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with PYY include Anorexia Nervosa and N-Acetylglutamate Synthase Deficiency.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0060575 intestinal epithelial cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
  • Length:  36
  • Propeptide:  NA
  • Signal peptide:  MVFVRRPWPALTTVLLALLVCLGALVDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005681_AF2.pdbhor005681_ESM.pdb

Physical Information

Mass: 480721 Formula: C185H286N52O55S2
Absent amino acids: CFHKSW Common amino acids: AP
pI: 6.6 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 10
Hydrophobicity: -78.06 Boman Index: -8239
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65.28
Instability Index: 6316.39 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  3202875
  • Title:  Isolation and primary structure of human peptide YY.
  • PubMed ID:  2587421
  • Title:  A new molecular form of PYY: structural characterization of human PYY(3-36) and PYY(1-36).